HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
PNC-27HPLC ≥ 99%MS confirmed10mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | PNC-27 |
|---|---|
| CAS number | 1159861-00-3 |
| Molecular formula | C188H293N53O44S |
| Molecular weight | 4031.7 g/mol |
| Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Form | Lyophilized powder, glass vial |
| Purity target | ≥ 99% by HPLC |
| Vial formats | 10mg |
| Documentation | Batch-document availability confirmed by product, specification and applicable lot |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder at -20°C (long-term -80°C), protected from light and moisture; ships on cold packs. After reconstitution, store at 2-8°C, minimize freeze-thaw cycles, and use within the validated stability window. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| OEM lot | 50 kits (500 vials) | 3–7 days |
| Production lot | 500–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
Supplied as a research-use peptide. Every quote confirms current-batch COA, purity, destination market and buyer track before invoicing.
Overview
About PNC-27.
PNC-27 is a synthetic 32-amino-acid chimeric peptide that fuses residues 12-26 of the HDM-2 (HDM2/MDM2) binding domain of human p53 to a membrane-residency / penetratin-derived leader sequence (MRP). In published research it is characterized as an anticancer tool compound that adopts an HDM-2-binding conformation, binds HDM-2 in the plasma membrane, and induces selective trans-membrane pore formation and membranolysis in cancer cells while sparing normal cells.
Documentation
Batch documentation support for PNC-27 lots.
batch-document availability confirmed by product, specification and applicable lot. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the PNC-27 reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
PNC-27 — frequently asked by B2B buyers.
What is PNC-27 and what is it used for?
PNC-27 is a synthetic 32-amino-acid chimeric peptide combining a p53-derived HDM-2 binding domain (residues 12-26) with a penetratin-type membrane-residency leader. It is supplied strictly for in-vitro and laboratory research use; we do not provide medical or dosing guidance.
What documentation ships with each batch?
For the applicable lot, Pepti confirms whether available documentation includes a batch-linked COA including RP-HPLC purity, mass-spectrometry (ESI/MALDI) identity confirmation, and appearance and water-content data. COA, HPLC and MS files are available on request prior to purchase.
What purity and format do you supply?
PNC-27 is supplied as a lyophilized powder filled into 10 ml vials. Typical purity is >=99% by HPLC target; the exact specification is confirmed on the batch COA and at RFQ.
What is the MOQ, and do you offer OEM / private-label?
Catalog MOQ is 50 kits (500 vials) (10 ml). We support bulk, OEM and private-label programs, including custom fill volume, labeling and packaging. Send your target volumes for a quotation.
How should PNC-27 be stored and shipped?
Lyophilized PNC-27 is stored at -20°C (long-term -80°C) and shipped with cold packs. After reconstitution keep at 2-8°C, protect from light and moisture, and avoid repeated freeze-thaw cycles.
Related compounds
Related research peptides.
COA library search
Search public COAs for this product.
The public COA library is being expanded by product and specification. Use the search link below to check current public records for this item.