HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
PNC-27HPLC ≥ 98%MS confirmed10mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | PNC-27 |
|---|---|
| CAS number | 1159861-00-3 |
| Class | Neuro & other |
| Molecular formula | C188H293N53O44S |
| Molecular weight | 4031.7 g/mol |
| Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Form | Lyophilized powder, sterile glass vial |
| Purity target | ≥ 98% by HPLC |
| Vial formats | 10mg |
| Documentation | COA + HPLC + MS, batch lot file where available |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder at -20°C (long-term -80°C), protected from light and moisture; ships on cold packs. After reconstitution, store at 2-8°C, minimize freeze-thaw cycles, and use within the validated stability window. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| Sample lot | From 50 vials | 3–7 days |
| Production lot | 200–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
PNC-27 is a synthetic 32-residue chimeric p53-penetratin research peptide (CAS 1159861-00-3) studied in oncology models for HDM-2-dependent, cancer-cell-selective membrane pore formation.
Documentation
Batch documentation support for PNC-27 lots.
COA / HPLC / MS document support where available. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the PNC-27 reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
PNC-27 — frequently asked by B2B buyers.
What is PNC-27 and what is it used for?
PNC-27 is a synthetic 32-amino-acid chimeric peptide combining a p53-derived HDM-2 binding domain (residues 12-26) with a penetratin-type membrane-residency leader. It is supplied strictly for in-vitro and laboratory research use; we do not provide medical, clinical or dosing guidance.
What documentation ships with each batch?
Every lot ships with a Certificate of Analysis including RP-HPLC purity, mass-spectrometry (ESI/MALDI) identity confirmation, and appearance and water-content data. COA, HPLC and MS files are available on request prior to purchase.
What purity and format do you supply?
PNC-27 is supplied as a lyophilized powder filled into 10 mg vials. Typical purity is >=98% by HPLC; the exact specification is confirmed on the batch COA and at RFQ.
What is the MOQ, and do you offer OEM / private-label?
Catalog MOQ is 50 vials (10 mg). We support bulk, OEM and private-label programs, including custom fill volume, labeling and packaging. Send your target volumes for a quotation.
How should PNC-27 be stored and shipped?
Lyophilized PNC-27 is stored at -20°C (long-term -80°C) and shipped with cold packs. After reconstitution keep at 2-8°C, protect from light and moisture, and avoid repeated freeze-thaw cycles.
Related compounds