HPLC purity
Reverse-phase HPLC with UV detection; ≥≥99% area purity target on each production lot.
Antimicrobial · innate immunity · worldwide
LL-37 wholesale & OEM supply.
Lyophilized LL-37 cathelicidin for research labs, qualified B2B research buyers, and private-label brand owners. ≥99% HPLC purity target with batch-linked COA, HPLC chromatogram and MS identity record. Reply ≤4h.
Lot LL37-2
HPLC ≥ ≥99%
MS confirmed
2 mg
Vial illustrations reflect supplied lyophilized format. Lot codes are sample identifiers; production lots carry their own batch references and document pack.
| Compound | LL-37 (Cathelicidin antimicrobial peptide) |
|---|---|
| Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Molecular weight | ≈ 4493 g/mol |
| Form | Lyophilized powder, glass vial |
| Purity target | ≥ ≥99% by HPLC |
| Vial formats | 2 mg (custom on request) |
| Documentation | Batch-linked COA + HPLC chromatogram + MS identity record for every production lot |
| Storage | 2–8 °C protected from light; long-term −20 °C |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| Sample lot | From 50 vials | 3–7 days |
| Production lot | 200–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
Pricing is tier-based and quoted per inquiry. Add LL-37 to the Quote Cart for a precise reply within 4 business hours.
Documentation
Every LL-37 vial ships with a lot file.
COA, HPLC chromatogram, MS identity confirmation, water content and storage notes. We do not invoice without context — buyer track and destination are confirmed first.
MS identity
Mass spectrometry identity confirmation against the LL-37 reference mass profile.
Lot traceability
Lot code is printed on the vial label and reflected in the document pack. Reorders cite the prior lot for continuity.
FAQ
Common LL-37 questions from B2B buyers.
What is LL-37 used for in research contexts?
LL-37 is a 37-amino-acid cathelicidin peptide and the only cathelicidin found in humans. It is studied for its role in innate immunity, antimicrobial activity, and modulation of inflammatory responses. Research labs and qualified B2B research buyers source lyophilized LL-37 for protocol development and laboratory study.
What is your minimum order quantity?
Sample lots from 50 vials; production lots start at 200 vials with tier pricing. Repeat OEM orders are scheduled in 1,000-vial batches with locked packaging.
What documentation do you ship with each lot?
Every production lot includes a batch-linked COA, HPLC chromatogram and MS identity record with lot traceability. Buyers can review batch documents and use independent testing before scaling.
Can you do private-label LL-37 packaging?
Yes. Neutral or branded vial labels, carton design, document packs, and lot-code handling are available for repeat OEM supply. See the OEM service path for the full process.
How do you ship internationally?
Lyophilized LL-37 ships at controlled temperature with documentation. Destination country and buyer track are confirmed before shipment. We work with B2B and research buyers, not consumers.
Related compounds