HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
Pepti · Catalog · VIP (Vasoactive Intestinal Peptide)
Neuropeptide · VPAC1/VPAC2 agonist · research-use
VIP peptide OEM supply.
Vasoactive intestinal peptide synthesized as the C-terminally amidated 28-mer, supplied as lyophilized powder with HPLC/MS documentation for research and private-label programs.
VIP (Vasoactive InHPLC ≥ 98%MS confirmed10mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | VIP (Vasoactive Intestinal Peptide) |
|---|---|
| CAS number | 40077-57-4 |
| Class | Neuro & other |
| Molecular formula | C147H238N44O42S |
| Molecular weight | 3325.8 g/mol |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Form | Lyophilized powder, sterile glass vial |
| Purity target | ≥ 98% by HPLC |
| Vial formats | 10mg / 5mg |
| Documentation | COA + HPLC + MS, batch lot file where available |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder at -20°C protected from light and moisture; -80°C recommended for long-term storage. After reconstitution keep at 2-8°C and use within a short window. As with all peptides, avoid repeated freeze-thaw cycles. Ships with COA. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| Sample lot | From 50 vials | 3–7 days |
| Production lot | 200–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
VIP (vasoactive intestinal peptide) is a 28-amino-acid vasoactive neuropeptide and VPAC1/VPAC2 receptor agonist, supplied as a lyophilized research-grade powder for B2B and OEM/private-label programs.
Documentation
Batch documentation support for VIP (Vasoactive Intestinal Peptide) lots.
COA / HPLC / MS document support where available. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the VIP (Vasoactive Intestinal Peptide) reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
VIP (Vasoactive Intestinal Peptide) — frequently asked by B2B buyers.
What form and vial sizes is VIP supplied in?
VIP is supplied as a lyophilized (freeze-dried) white powder synthesized as the C-terminally amidated 28-amino-acid sequence. Catalog fill sizes are 10mg and 5mg vials; bulk quantities and custom fill are available on RFQ.
What documentation ships with each lot?
Each lot ships with a Certificate of Analysis including RP-HPLC purity and mass-spectrometry (ESI-MS/MALDI) identity confirmation. Sequence data, net-peptide/counter-ion content and endotoxin figures can be provided on request.
What is the minimum order quantity?
The standard catalog MOQ is 50 vials. Larger bulk orders and OEM/private-label programs are quoted per RFQ, with volume pricing available.
Do you support private-label / OEM programs for VIP?
Yes. Pepti supplies VIP for private-label and OEM programs, including custom vial fill, labeling and documentation. VIP is offered for laboratory research and manufacturing use only, not for human or veterinary use.
How is purity verified?
Purity is verified by reversed-phase HPLC, with molecular identity confirmed by mass spectrometry against the expected amidated 28-mer mass (approximately 3325.8 g/mol). Batch-specific purity is stated on the COA.
Related compounds