HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
IGF-1 DESHPLC ≥ 99%MS confirmed2 mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | IGF-1 DES(1,3) |
|---|---|
| CAS number | 112603-35-7 |
| Molecular formula | C319H495N91O96S7 |
| Molecular weight | 7365.4 g/mol |
| Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Form | Lyophilized powder, glass vial |
| Purity target | ≥ 99% by HPLC |
| Vial formats | 2 mg |
| Documentation | Batch-document availability confirmed by product, specification and applicable lot |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder desiccated at -20 °C, protected from light; long-term stability is best preserved frozen. After reconstitution, keep refrigerated at 2-8 °C for short-term use, or aliquot and freeze at -20 °C to avoid repeated freeze-thaw cycles. Research-use only. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| OEM lot | 50 kits (500 vials) | 3–7 days |
| Production lot | 500–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
Supplied as a research-use peptide. Every quote confirms current-batch COA, purity, destination market and buyer track before invoicing.
Overview
About IGF-1 DES(1,3).
IGF-1 DES(1,3) is a truncated recombinant analog of insulin-like growth factor 1 in which the first three N-terminal residues (Gly-Pro-Glu) are deleted, leaving a 67-amino-acid chain. Removal of this tripeptide markedly lowers affinity for the IGF-binding proteins (IGFBPs), which has made it a widely used reference tool compound in IGF-1 receptor and growth-factor signaling research.
Documentation
Batch documentation support for IGF-1 DES(1,3) lots.
batch-document availability confirmed by product, specification and applicable lot. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the IGF-1 DES(1,3) reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
IGF-1 DES(1,3) — frequently asked by B2B buyers.
What format and vial size is IGF-1 DES(1,3) supplied in?
It ships as a sterile-filtered, white lyophilized powder in 2 mg vials. Larger bulk quantities and alternative fills can be quoted on RFQ.
What documentation is included with each batch?
Each batch ships with a Certificate of Analysis covering HPLC purity, mass-spectrometry identity confirmation, and appearance. Additional test reports or third-party verification can be arranged on request.
What purity level can you supply?
Typical supply is high-purity material verified by HPLC, with the exact per-batch specification stated on the accompanying COA. Purity targets can be aligned to your requirements at order stage.
What is the MOQ, and do you offer private-label / OEM services?
MOQ is quoted on request. As a China-based OEM manufacturer we support private-label programs including custom labeling, vial sizes, kitting, and documentation for B2B and brand buyers.
Is IGF-1 DES(1,3) intended for therapeutic use?
No. It is offered strictly as a research-use-only material and as a manufacturing/laboratory input. It is not sold for consumer or veterinary use, diagnosis, or treatment.
Related compounds
Related research peptides.
COA library search
Search public COAs for this product.
The public COA library is being expanded by product and specification. Use the search link below to check current public records for this item.