HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
IGF-1 DES(1,3)HPLC ≥ 98%MS confirmed2 mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | IGF-1 DES(1,3) |
|---|---|
| CAS number | 112603-35-7 |
| Class | Growth-hormone axis & repair |
| Molecular formula | C319H495N91O96S7 |
| Molecular weight | 7365.4 g/mol |
| Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Form | Lyophilized powder, sterile glass vial |
| Purity target | ≥ 98% by HPLC |
| Vial formats | 2 mg |
| Documentation | COA + HPLC + MS, batch lot file where available |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder desiccated at -20 °C, protected from light; long-term stability is best preserved frozen. After reconstitution, keep refrigerated at 2-8 °C for short-term use, or aliquot and freeze at -20 °C to avoid repeated freeze-thaw cycles. Research-use only. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| Sample lot | From 50 vials | 3–7 days |
| Production lot | 200–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
IGF-1 DES(1,3) is a 67-amino-acid truncated analog of insulin-like growth factor 1 that lacks the N-terminal Gly-Pro-Glu tripeptide, supplied as a lyophilized research-use powder for laboratory and private-label OEM buyers.
Documentation
Batch documentation support for IGF-1 DES(1,3) lots.
COA / HPLC / MS document support where available. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the IGF-1 DES(1,3) reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
IGF-1 DES(1,3) — frequently asked by B2B buyers.
What format and vial size is IGF-1 DES(1,3) supplied in?
It ships as a sterile-filtered, white lyophilized powder in 2 mg vials. Larger bulk quantities and alternative fills can be quoted on RFQ.
What documentation is included with each batch?
Each batch ships with a Certificate of Analysis covering HPLC purity, mass-spectrometry identity confirmation, and appearance. Additional test reports or third-party verification can be arranged on request.
What purity level can you supply?
Typical supply is high-purity material verified by HPLC, with the exact per-batch specification stated on the accompanying COA. Purity targets can be aligned to your requirements at order stage.
What is the MOQ, and do you offer private-label / OEM services?
MOQ is quoted on request. As a China-based OEM manufacturer we support private-label programs including custom labeling, vial sizes, kitting, and documentation for B2B and brand buyers.
Is IGF-1 DES(1,3) intended for human use?
No. It is offered strictly as a research-use-only material and as a manufacturing/laboratory input. It is not sold for human or veterinary use, diagnosis, or treatment.
Related compounds