HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
FOXO4-DRIHPLC ≥ 98%MS confirmed10mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | FOXO4-DRI |
|---|---|
| CAS number | 2460055-10-9 |
| Class | Longevity, cognitive & bioregulators |
| Molecular formula | C228H388N86O64 |
| Molecular weight | 5358.06 g/mol (free base) — CONFIRMED. Do NOT use the claimed acetate value of 5366.8 g/mol; it is chemically impossible (adding acetate to the 5358 free base cannot yield 5366.8). Authoritative acetate salt MW is ≈6019 g/mol (MedChemExpress HY-P4157A; ~11 acetate counterions, consistent with 14 basic residues). Since acetate counterion count is not standardized across vendors, list free base 5358.06 g/mol as the primary spec and show acetate 'on request'. |
| Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (46 residues, all D-amino acids, D-retro-inverso orientation) |
| Form | Lyophilized powder, sterile glass vial |
| Purity target | ≥ 98% by HPLC |
| Vial formats | 10mg |
| Documentation | COA + HPLC + MS, batch lot file where available |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder at -20°C, protected from light and moisture; stable for extended periods when sealed with desiccant. After reconstitution, keep at 2–8°C for short-term research use or aliquot and store at -20°C to avoid repeated freeze-thaw. Cold-chain shipping available where required. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| Sample lot | From 50 vials | 3–7 days |
| Production lot | 200–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
FOXO4-DRI is a 46-residue cell-penetrating D-retro-inverso peptide that blocks the FOXO4–p53 protein interaction, supplied as a research-use lyophilized powder.
Documentation
Batch documentation support for FOXO4-DRI lots.
COA / HPLC / MS document support where available. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the FOXO4-DRI reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
FOXO4-DRI — frequently asked by B2B buyers.
What format and vial size is FOXO4-DRI supplied in?
It is supplied as a sterile-filtered, lyophilized white-to-off-white powder in 10mg vials. Custom fill weights and bulk quantities are available on request for OEM and private-label programs.
What purity and documentation come with each batch?
Every batch ships with a Certificate of Analysis showing RP-HPLC purity (typically ≥98%) and identity confirmed by mass spectrometry. Supplementary data such as water content, residual solvents, and acetate content can be provided on request.
What is the minimum order quantity?
MOQ is 50 vials at the 10mg size. Larger private-label and bulk quantities are quoted per RFQ with volume-based pricing and lead times confirmed at order.
Can Pepti handle private-label and custom packaging?
Yes. As a China-based OEM/private-label manufacturer we offer custom labeling, vial and box configurations, kitting with reconstitution ancillaries, and tailored documentation packages for downstream research distributors.
Is FOXO4-DRI sold for human use?
No. FOXO4-DRI is supplied strictly for laboratory and research use only — not for human or veterinary use, nor for diagnostic or therapeutic application. Buyers are responsible for compliance with import and research-use regulations in their jurisdiction.
Related compounds