HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
FOXO4-DRIHPLC ≥ 98%MS confirmed2mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | FOXO4-DRI |
|---|---|
| CAS number | 2460055-10-9 |
| Class | Longevity, cognitive & bioregulators |
| Molecular formula | C228H388N86O64 |
| Molecular weight | 5358.15 g/mol (free base) |
| Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (46 residues, all-D retro-inverso) |
| Form | Lyophilized powder, sterile glass vial |
| Purity target | ≥ 98% by HPLC |
| Vial formats | 2mg / 10mg |
| Documentation | COA + HPLC + MS, batch lot file where available |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder at -20 °C; ship on cold packs. After reconstitution keep at 2-8 °C and use within the validated window. Protect from light and avoid repeated freeze-thaw cycles. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| Sample lot | From 50 vials | 3–7 days |
| Production lot | 200–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
FOXO4-DRI is a synthetic all-D retro-inverso peptide (CAS 2460055-10-9) studied as a senolytic that disrupts the FOXO4-p53 interaction to trigger apoptosis selectively in senescent cells.
Documentation
Batch documentation support for FOXO4-DRI lots.
COA / HPLC / MS document support where available. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the FOXO4-DRI reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
FOXO4-DRI — frequently asked by B2B buyers.
What vial sizes and MOQ does Pepti offer for FOXO4-DRI?
FOXO4-DRI is stocked as lyophilized powder in 2 mg and 10 mg vials, with a minimum order of 50 vials. Larger bulk quantities and custom fills are quoted on RFQ.
What documentation ships with each batch?
Every lot ships with a batch-specific certificate of analysis showing HPLC purity and mass-spec (MS) identity confirmation. Additional COA parameters and third-party testing can be arranged on request.
Is FOXO4-DRI a D-amino-acid retro-inverso peptide?
Yes. FOXO4-DRI is synthesized as an all-D-amino-acid retro-inverso construct — the residue order is reversed and built from D-amino acids — which is characteristic of this molecule and improves proteolytic stability versus a native L-peptide.
Can Pepti support private-label and OEM programs for FOXO4-DRI?
Yes. We supply bulk peptide and support private-label filling, custom vial sizing, and label/packaging for research-use brands. Regulatory positioning and compliance in the buyer's market remain the buyer's responsibility.
What purity can be specified?
FOXO4-DRI is typically supplied at 98%+ by HPLC. Exact purity, net-peptide content, endotoxin, and residual-solvent specifications are confirmed per lot on the COA and can be tailored on RFQ.
Related compounds