HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
ACTH 1-39HPLC ≥ 99%MS confirmed5mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | ACTH 1-39 |
|---|---|
| CAS number | 12279-41-3 |
| Molecular formula | C207H308N56O58S |
| Molecular weight | 4541.07 |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Form | Lyophilized powder, glass vial |
| Purity target | ≥ 99% by HPLC |
| Vial formats | 5mg |
| Documentation | Batch-document availability confirmed by product, specification and applicable lot |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder at -20°C, protected from light and moisture; stable for extended periods when sealed. After reconstitution, keep at 2-8°C and use within a short window, or aliquot and store frozen to avoid repeated freeze-thaw cycles. Avoid prolonged exposure to room temperature. For laboratory research use only. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| OEM lot | 50 kits (500 vials) | 3–7 days |
| Production lot | 500–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
Supplied as a research-use peptide. Every quote confirms current-batch COA, purity, destination market and buyer track before invoicing.
Overview
About ACTH 1-39.
ACTH 1-39 is the full-length adrenocorticotropic hormone, a 39-residue peptide cleaved from the proopiomelanocortin (POMC) precursor. In research models it acts as a potent endogenous agonist at the melanocortin-2 receptor (MC2R), driving glucocorticoid synthesis and secretion in the adrenal cortex, and is widely used as a reference standard in HPA-axis and steroidogenesis studies.
Documentation
Batch documentation support for ACTH 1-39 lots.
batch-document availability confirmed by product, specification and applicable lot. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the ACTH 1-39 reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
ACTH 1-39 — frequently asked by B2B buyers.
What vial size and MOQ does Pepti offer for ACTH 1-39?
ACTH 1-39 is stocked as 5mg lyophilized vials with a minimum order quantity of 50 kits (500 vials). Larger volumes, bulk lyophilized powder and custom fill sizes are available on RFQ for OEM and private-label programs.
What documentation ships with each batch?
For the applicable lot, Pepti confirms whether available documentation includes a batch-linked COA covering HPLC purity and mass-spectrometry identity confirmation. Additional documentation such as residual-solvent, water-content or endotoxin (only if specifically ordered and tested) data can be provided on request to support your incoming-QC requirements.
How is identity and purity confirmed?
Identity is verified by mass spectrometry against the expected molecular weight (≈4541 g/mol) for the 39-residue sequence, and purity is quantified by RP-HPLC. Specific purity thresholds and method details are confirmed per batch on the COA.
Is this human or rat ACTH 1-39?
The standard catalog form is human ACTH 1-39 (CAS 12279-41-3, sequence SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF). The rat variant is a distinct molecule (CAS 77465-10-2); specify the species required at RFQ so the correct sequence is supplied.
Can Pepti support private-label and OEM orders?
Yes. As a China-based manufacturer and OEM supplier, Pepti supports private-label labeling, custom vial fills and bulk supply. All material is provided for research use only and is not sold for therapeutic or consumer use.
Related compounds
Related research peptides.
COA library search
Search public COAs for this product.
The public COA library is being expanded by product and specification. Use the search link below to check current public records for this item.